Vascular Endothelial Growth Factor (VEGF) is a potent mediator of both angiogenesis and vesculogenesis in the fetus and adult. It stimulates proliferation and survival of endothelial cells and promotes angiogenesis and vascular permeability. VEGF is a secreted homodimeric protein secreted by a variety of vascularized tissues. Human recombinant VEGF165 is a 38.2 kDa disulfide-linked homodimeric protein consisting of two 165amino acid polypeptide chain. |
Amino acid sequence : | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDE GLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLF VQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Source : | Escherichia Coli. |
Purity : |
Greater than 98%, as determined by SDS-PAGE.
SDS-PAGE analysis of Recombinant human VEGF-165 Sample:
![]() |
Endotoxin : | < 1.0 EU/μg of protein as determined by the LAL assay. |
Bioactivity : | ED50 ≤ 1.0ng/mg as determined by the dose dependent proliferation of murine BABL/c 3T3 cells. |
Formulation : | Sterile filtered through a 0.2 micron filter. Lyophilized with no additives. |
Storage/Stability : | This product is shipped at 4°C. with cold pack. It is stable for up to 6 months from date of receipt when stored at -20°C. Multiple freeze/thaw cycles should be avoided as it can result in significant loss of activity. |
Reconstitution ; | Centrifuge the vial before opening. Reconstitute in sterile water to a concentration of 0.1 -1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. |