Vitronectin-398™ (Xeno-free)
ES Quality Recombinant Human
Human VTN (Vitronectin) is a 478 amino acid protein (1-19 = signal domain) that belongs to a member of the pexin family. Vitronectin is an abundant glycoprotein found in serum and the extracellular matrix. It promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Vitronectin has been speculated to be involved in hemostasis and tumor malignancy. Recent publication from James Thomson’s group indicated that coated recombinant human vitronectin protein alone benefits iPS cell generation when combined with E8 culture medium.
Recombinant human Vitronectin gene (20-398 aa Fragment) was constructed with codon optimization and expressed in non-fusion protein form in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. Coating this recombinant protein at 5-10 µg / well (6 well plate) in either NutirStem or E8 medium can be used for human iPS cell generation in vitro.
Freatures
✔ Non-Fusion Protein
✔ User Friendly Protocol
✔ Cost Effective
Human ES cells (H1) were cultivated in xeno-free medium (NutriStem™) on Vitronectin-398™ (Xeno-Free) coated 6-well plate for 10 generations, and staining With Oct4, TRA-81 and DAPI.
Domain Structure
Recombinant human Vitronectin gene (20-398 aa Fragment) was constructed with codon optimization and expressed in non-fusion protein form in E.coli as inclusion bodies. The final product was refolded using our unique "temperature shift inclusion body refolding" technology and chromatographically purified. Coating this recombinant protein at 5-10 µg / well (6 well plate) in either NutirStem or E8 medium can be used for human iPS cell generation in vitro.
Product Information
|
Accession Number
|
NP_000629
|
|
Species
|
Human
|
|
Composition
|
0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation buffer containing sucrose, EDTA, Arginine and DTT.
|
|
Storage
|
In liquid. Keep at -80C for long term storage. Product is stable at 4C for at least 30 days.
|
|
Application
|
1. As coating matrix protein for maintaining long-term ES or iPS cell culture before combining with E8 culture medium.
2. As an excellent coating matrix material of 11R-tagged recombinant TF intracellular delivery for protein derived iPS protocol with extremely low-level non-specific interaction. |
|
Quality control
|
>95% by SDS-PAGE
Each lot was tested with human ES cell (H1) culture using 5-10 μg in 1 ml Nutristem medium per well (6-well plate). |
|
Coating Protocol
|
Use 1 ml PBS per well, add 5-10 μg protein to each well and incubate at 4°C overnight.
After coating, remove PBS solution, the plate is ready for ES cell cultivation. |
Recombinant Protein Sequence
MDQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGE EKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGR PQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAF TRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFF KGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRD WHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSR
Vitronectin-398 (Xeno-free) (Instruction)Reference
Ordering Information
| Product | Storage | Cat.No. | PKG Size | Price | |
|---|---|---|---|---|---|
| Vitronectin-398™ (Xeno-free), Recombinant Human | -80°C | NU0006 | 500 µg | 99.00 | Buy |
Keep at -80C for long term storage. Product is stable at 4C for at least 30 days.